Gene Rv3500c (supB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown. Predicted to be involved in lipid catabolism. |
| Product | Conserved integral membrane protein YrbE4B. Possible ABC transporter. |
| Comments | Rv3500c, (MTV023.07c), len: 280 aa. YrbE4B, conserved integral membrane protein, part of mce4 operon and member of YrbE family (see citations below), highly similar to Mycobacterium tuberculosis proteins O07413|Rv0168|MTCI28.08|yrbE1B (289 aa); O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa); and O53966|Rv1965|MTV051.03|yrbE3B (271 aa). Also highly similar to conserved hypothetical integral membrane proteins of the P45030|YRBE_HAEIN (261 aa) type, e.g. Q9CD15|YRBE1B|ML2588 from Mycobacterium leprae (289 aa), FASTA scores: opt: 973, E(): 1.5e-50, (50.2% identity in 269 aa overlap); P45030|YRBE_HAEIN|HI1086 from Haemophilus influenzae (261 aa), FASTA scores: opt: 270, E(): 6e-11, (25.4% identity in 264 aa overlap); etc. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3919220 | 3920062 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3500c|yrbE4B
MSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVRLVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALTGFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDHYFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG
Bibliography
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function Product
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
