Gene Mb3533c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE FERREDOXIN FDXD |
| Comments | Mb3533c, fdxD, len: 63 aa. Equivalent to Rv3503c,len: 63 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 63 aa overlap). Probable fdxD,ferredoxin, equivalent to Q9R6Z5|B229_C3_226 HYPOTHETICAL 9.3 KDA PROTEIN from Mycobacterium leprae (83 aa) FASTA scores: opt: 276, E(): 1.8e-13, (75.9% identity in 54 aa overlap). Also similar to several e.g. Q9R6Z5|PHDC from Nocardioides sp. strain KP7 (69 aa), FASTA scores: opt: 177, E(): 2.1e-06, (43.35% identity in 60 aa overlap); Q9X4X8|DITA3 DIOXYGENASE DITA FERREDOXIN COMPONENT from Pseudomonas abietaniphila (78 aa), FASTA scores: opt: 166,E(): 1.4e-05, (36.2% identity in 58 aa overlap); P00203|FER_MOOTH from Moorella thermoacetica (Clostridium thermoaceticum) (63 aa), FASTA scores: opt: 157, E(): 5.4e-05, (36.65% identity in 60 aa overlap); P18325|FER2_STRGO|SUBB from Streptomyces griseolus (64 aa) FASTA scores: opt: 157, E(): 5.5e-05, (39.35% identity in 61 aa overlap); etc. BELONGS TO THE BACTERIAL TYPE FERREDOXIN FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3867688 | 3867879 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3533c|fdxD
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE
Bibliography
No article yet recorded