Gene Rv3503c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| Product | Probable ferredoxin FdxD |
| Comments | Rv3503c, (MTV023.10c), len: 63 aa. Probable fdxD, ferredoxin, equivalent to Q9R6Z5|B229_C3_226 hypothetical 9.3 KDA protein from Mycobacterium leprae (83 aa) FASTA scores: opt: 276, E(): 1.8e-13, (75.9% identity in 54 aa overlap). Also similar to several e.g. Q9R6Z5|PHDC from Nocardioides sp. strain KP7 (69 aa), FASTA scores: opt: 177, E(): 2.1e-06, (43.35% identity in 60 aa overlap); Q9X4X8|DITA3 dioxygenase DITA ferredoxin component from Pseudomonas abietaniphila (78 aa), FASTA scores: opt: 166, E(): 1.4e-05, (36.2% identity in 58 aa overlap); P00203|FER_MOOTH from Moorella thermoacetica (Clostridium thermoaceticum) (63 aa), FASTA scores: opt: 157, E(): 5.4e-05, (36.65% identity in 60 aa overlap); P18325|FER2_STRGO|SUBB from Streptomyces griseolus (64 aa) FASTA scores: opt: 157, E(): 5.5e-05, (39.35% identity in 61 aa overlap); etc. Belongs to the bacterial type ferredoxin family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3922065 | 3922256 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3503c|fdxD
VRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
