Gene Mb3577
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | deazaflavin-dependent nitroreductase ddn |
| Comments | Mb3577, -, len: 151 aa. Equivalent to Rv3547, len: 151 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 151 aa overlap). Conserved hypothetical protein, similar to other hypothetical proteins e.g. O85698|3SCF60.07 from Streptomyces lividans and Streptomyces coelicolor (149 aa), FASTA scores: opt: 353, E(): 6.3e-17, (42.55% identity in 134 aa overlap); Q9WX21|SCE68.11 from Streptomyces coelicolor (305 aa) FASTA scores: opt: 290, E(): 2.1e-12, (38.5% identity in 122 aa overlap) (similarity in N-terminus for this protein); BAB52932|Q988L5|MLL6688 from Rhizobium loti (Mesorhizobium loti) (148 aa), FASTA scores: opt: 105,E(): 3, (26.75% identity in 86 aa overlap). Also similar to mycobacterial hypothetical proteins e.g. Q9ZH81 from M. paratuberculosis (144 aa), FASTA scores: opt: 366, E(): 8.2e-18, (43.9% identity in 123 aa overlap); and Q10772|YF58_MYCTU|Rv1558|MT1609|MTCY48.07c from M. tuberculosis (148 aa), FASTA scores: opt: 330, E(): 2.2e-15, (39.75% identity in 151 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3930059 | 3930514 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3577|ddn
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP
Bibliography
No article yet recorded
