Gene Mb3587c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein (probably tetr-family) |
| Comments | Mb3587c, -, len: 200 aa. Equivalent to Rv3557c,len: 200 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 200 aa overlap). Probable transcriptional regulator, tetR family, similar to other e.g. Q9RRV9|DR2376 from Deinococcus radiodurans (197 aa) FASTA scores: opt: 326, E(): 2.3e-14, (31.2% identity in 189 aa overlap); Q9HZW2|PA2885 from Pseudomonas aeruginosa (198 aa), FASTA scores: opt: 308, E(): 3.5e-13, (31.55% identity in 187 aa overlap); Q9RFR4 from Pseudomonas fluorescens (207 aa), FASTA scores: opt: 291, E(): 4.7e-12, (29.75% identity in 195 aa overlap); Q9K8P5|BH2958 from Bacillus halodurans (215 aa), FASTA scores: opt: 271, E(): 9.9e-11, (23.95% identity in 192 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. O53641|Rv0158|MTV032.01 (214 aa), FASTA scores: opt: 232, E(): 3.5e-08, (25.5% identity in 192 aa overlap); and O06169|Rv2506|MTCY07A7.12 (215 aa), FASTA scores: opt: 215, E(): 4.5e-07, (35.15% identity in 148 aa overlap); etc. SEEMS TO BELONG TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3940244 | 3940846 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3587c|Mb3587c
MDRVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKEGV
Bibliography
No article yet recorded
