Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductTranscriptional regulatory protein (probably TetR-family)
CommentsRv3557c, (MTCY06G11.04c), len: 200 aa. Transcriptional regulator, TetR family, similar to other e.g. Q9RRV9|DR2376 from Deinococcus radiodurans (197 aa) FASTA scores: opt: 326, E(): 2.3e-14, (31.2% identity in 189 aa overlap); Q9HZW2|PA2885 from Pseudomonas aeruginosa (198 aa), FASTA scores: opt: 308, E(): 3.5e-13, (31.55% identity in 187 aa overlap); Q9RFR4 from Pseudomonas fluorescens (207 aa), FASTA scores: opt: 291, E(): 4.7e-12, (29.75% identity in 195 aa overlap); Q9K8P5|BH2958 from Bacillus halodurans (215 aa), FASTA scores: opt: 271, E(): 9.9e-11, (23.95% identity in 192 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. O53641|Rv0158|MTV032.01 (214 aa), FASTA scores: opt: 232, E(): 3.5e-08, (25.5% identity in 192 aa overlap); and O06169|Rv2506|MTCY07A7.12 (215 aa), FASTA scores: opt: 215, E(): 4.5e-07, (35.15% identity in 148 aa overlap); etc. Seems to belong to the TetR/AcrR family of transcriptional regulators.
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39970293997631-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3557c|Rv3557c
MDRVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKEGV