Gene Mb3597c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | HYPOTHETICAL PROTEIN |
| Comments | Mb3597c, -, len: 88 aa. Equivalent to Rv3566A, len: 88 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 88 aa overlap). Hypothetical unknown protein. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3951382 | 3951648 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3597c|Mb3597c
MSGADPPTRRAFGQMARAATGWVSVSGQFAVAADTCRCEGTLFAVDPETHVANHNRCDIVGRLRDERPNTLRSVRRGDEVRMATWHWI
Bibliography
No article yet recorded