Gene Rv3566A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv3566A, len: 88 aa. Hypothetical unknown protein. |
| Functional category | Conserved hypotheticals |
| Operon | Rv3567c and Rv3566A, Rv3566A and Rv3566c are co-transcribed in M. bovis BCG, by RT-PCR (See Anderton et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4008167 | 4008433 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3566A|Rv3566A
VSGADPPTRRAFGQMARAATGWVSVSGQFAVAADTCRCEGTLFAVDPETHVANHNRCDIVGRLRDERPNTLRSVRRGDEVRMATWHWI
Bibliography
- Anderton MC et al. [2006]. Characterization of the putative operon containing arylamine N-acetyltransferase (nat) in Mycobacterium bovis BCG. Operon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
