Gene Mb3606c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY LACI-FAMILY) |
| Comments | Mb3606c, -, len: 359 aa. Equivalent to Rv3575c,len: 359 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 359 aa overlap). Probable transcriptional regulator belonging to lacI family,similar to others e.g. BAB53947|MLL8376 from Rhizobium loti (Mesorhizobium loti) (358 aa), FASTA scores: opt: 707, E(): 2.6e-35, (35.5% identity in 355 aa overlap); Q9RRI9|DR2501 from Deinococcus radiodurans (359 aa) FASTA scores: opt: 544, E(): 1.6e-25, (40.35% identity in 347 aa overlap); Q9RL31|SCF51A.34 from Streptomyces coelicolor (347 aa), FASTA scores: opt: 307, E(): 2.9e-11, (30.0% identity in 330 aa overlap); O87590|CELR_THEFU from Thermomonospora fusca (340 aa), FASTA scores: opt: 280,E(): 1.2e-09, (32.3% identity in 353 aa overlap); P21867|RAFR_ECOLI from Escherichia coli (335 aa) FASTA scores: opt: 241, E(): 2.6e-07, (27.15% identity in 269 aa overlap); etc. Equivalent to AAK48039 from Mycobacterium tuberculosis strain CDC1551 (404 aa) but shorter 45 aa. Contains possible helix-turn-helix motif, at aa 9-30 (+5.86 SD). COULD BELONG TO THE LACI FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3960304 | 3961383 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3606c|Mb3606c
MSPTPRRRATLASLAAELKVSRTTVSNAFNRPDQLSADLRERVLATAKRLGYAGPDPVARSLRTRKAGAVGLVMAEPLTYFFSDPAARDFVAGVAQSCEELGQGLQLVSVGSSRSLADGTAAVLGAGVDGFVVYSVGDDDPYLQVVLQRRLPVVVVDQPKDLSGVSRVGIDDRAAMRELAGYVLGLGHRELGLLTMRLGRDRRQDLVDAERLRSPTFDVQRERIVGVWEAMTAAGVDPDSLTVVESYEHLPTSGGTAAKVALQANPRLTALMCTADILALSAMDYLRAHGIYVPGQMTVTGFDGVPEALSRGLTTVAQPSLHKGHRAGELLLKPPRSGLPVIEVLDTELVRGRTAGPPA
Bibliography
No article yet recorded