Gene Rv3575c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Transcriptional regulatory protein (probably LacI-family) |
| Comments | Rv3575c, (MTCY06G11.22c), len: 359 aa. Probable transcriptional regulator belonging to lacI family, similar to others e.g. BAB53947|MLL8376 from Rhizobium loti (Mesorhizobium loti) (358 aa), FASTA scores: opt: 707, E(): 2.6e-35, (35.5% identity in 355 aa overlap); Q9RRI9|DR2501 from Deinococcus radiodurans (359 aa) FASTA scores: opt: 544, E(): 1.6e-25, (40.35% identity in 347 aa overlap); Q9RL31|SCF51A.34 from Streptomyces coelicolor (347 aa), FASTA scores: opt: 307, E(): 2.9e-11, (30.0% identity in 330 aa overlap); O87590|CELR_THEFU from Thermomonospora fusca (340 aa), FASTA scores: opt: 280, E(): 1.2e-09, (32.3% identity in 353 aa overlap); P21867|RAFR_ECOLI from Escherichia coli (335 aa) FASTA scores: opt: 241, E(): 2.6e-07, (27.15% identity in 269 aa overlap); etc. Equivalent to AAK48039 from Mycobacterium tuberculosis strain CDC1551 (404 aa) but shorter 45 aa. Contains possible helix-turn-helix motif, at aa 9-30 (+5.86 SD). Could belong to the LacI family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4017089 | 4018168 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3575c|Rv3575c
VSPTPRRRATLASLAAELKVSRTTVSNAFNRPDQLSADLRERVLATAKRLGYAGPDPVARSLRTRKAGAVGLVMAEPLTYFFSDPAARDFVAGVAQSCEELGQGLQLVSVGSSRSLADGTAAVLGAGVDGFVVYSVGDDDPYLQVVLQRRLPVVVVDQPKDLSGVSRVGIDDRAAMRELAGYVLGLGHRELGLLTMRLGRDRRQDLVDAERLRSPTFDVQRERIVGVWEAMTAAGVDPDSLTVVESYEHLPTSGGTAAKVALQANPRLTALMCTADILALSAMDYLRAHGIYVPGQMTVTGFDGVPEALSRGLTTVAQPSLHKGHRAGELLLKPPRSGLPVIEVLDTELVRGRTAGPPA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant