Gene Mb3613c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 4-diphosphocytidyl-2c-methyl-d-erythritol synthase ispd (mep cytidylyltransferase) (mct) |
| Comments | Mb3613c, ispD, len: 231 aa. Equivalent to Rv3582c,len: 231 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 231 aa overlap). Probable ispD,4-diphosphocytidyl-2C-methyl-D-erythritol synthase (EC 2.7.7.-), equivalent to Q9CCW6|ML0321 PUTATIVE 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL SYNTHASE from Mycobacterium leprae (241 aa), FASTA scores: opt: 694,E(): 1.7e-35, (66.95% identity in 236 aa overlap). Also highly similar to others e.g. Q9L0Q8|ISPD_STRCO|SCD8A.06 from Streptomyces coelicolor (270 aa), FASTA scores: opt: 537, E(): 7.5e-26, (43.4% identity in 242 aa overlap); P74323|ISPD_SYNY3|SLR0951 from Synechocystis sp. strain PCC 6803 (230 aa), FASTA scores: opt: 410, E(): 3.8e-18,(36.15% identity in 224 aa overlap); Q9KGF8|ISPD_BACHD|BH0107 from Bacillus halodurans (228 aa) FASTA scores: opt: 367, E(): 1.6e-15, (34.65% identity in 228 aa overlap); Q08113|ISDF_RHOCA|ISPDF from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (379 aa)FASTA scores: opt: 359, E(): 7.8e-15, (34.1% identity in 223 aa overlap) (only similar with N-terminus of this bifunctional protein ISPD and ISPF); Q46893|ISPD_ECOLI|B2747 from Escherichia coli strain K12 (235 aa), FASTA scores: opt: 336, E(): 1.3e-13, (33.65% identity in 223 aa overlap); etc. BELONGS TO THE ISPD FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3967560 | 3968255 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3613c|ispD
MVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALAVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDLPAAEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Bibliography
No article yet recorded
