Gene Rv3582c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the third step). Catalyzes the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) from CTP and 2C-methyl-D-erythritol 4-phosphate (MEP). |
| Product | 4-diphosphocytidyl-2C-methyl-D-erythritol synthase IspD (MEP cytidylyltransferase) (MCT) |
| Comments | Rv3582c, (MT3688, MTCY06G11.29c), len: 231 aa. ispD, 4-diphosphocytidyl-2C-methyl-D-erythritol synthase , equivalent to Q9CCW6|ML0321 putative 4-diphosphocytidyl-2C-methyl-D-erythritol synthase from Mycobacterium leprae (241 aa), FASTA scores: opt: 694, E(): 1.7e-35, (66.95% identity in 236 aa overlap). Also highly similar to others e.g. Q9L0Q8|ISPD_STRCO|SCD8A.06 from Streptomyces coelicolor (270 aa), FASTA scores: opt: 537, E(): 7.5e-26, (43.4% identity in 242 aa overlap); P74323|ISPD_SYNY3|SLR0951 from Synechocystis sp. strain PCC 6803 (230 aa), FASTA scores: opt: 410, E(): 3.8e-18, (36.15% identity in 224 aa overlap); Q9KGF8|ISPD_BACHD|BH0107 from Bacillus halodurans (228 aa) FASTA scores: opt: 367, E(): 1.6e-15, (34.65% identity in 228 aa overlap); Q08113|ISDF_RHOCA|ISPDF from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (379 aa)FASTA scores: opt: 359, E(): 7.8e-15, (34.1% identity in 223 aa overlap) (only similar with N-terminus of this bifunctional protein ISPD and ISPF); Q46893|ISPD_ECOLI|B2747 from Escherichia coli strain K12 (235 aa), FASTA scores: opt: 336, E(): 1.3e-13, (33.65% identity in 223 aa overlap); etc. Belongs to the ISPD family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4024344 | 4025039 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3582c|ispD
VVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDLPAAEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Eoh H et al. [2007]. Characterization of the Mycobacterium tuberculosis 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase: potential for drug development. Product Function
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant