Gene Mb3614c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible transcription factor |
| Comments | Mb3614c, -, len: 162 aa. Equivalent to Rv3583c,len: 162 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 162 aa overlap). Possible transcriptional factor, identical to Q9CCW7|ML0320 PUTATIVE TRANSCRIPTION FACTOR from Mycobacterium leprae (165 aa), FASTA scores: opt: 1004, E(): 6.1e-56, (97.55% identity in 162 aa overlap); and Q9ZBM8|MLCB1450.01c PUTATIVE TRANSCRIPTIONAL REGULATOR from Mycobacterium leprae (94 aa), FASTA scores: opt: 600, E(): 6e-31,(97.85% identity in 94 aa overlap). Also highly similar to others e.g. Q9L0Q9|SCD8A.05 from Streptomyces coelicolor (160 aa), FASTA scores: opt: 878, E(): 4.3e-48, (85.0% identity in 160 aa overlap); Q9K600|BH3935 from Bacillus halodurans (153 aa) FASTA scores: opt: 383, E(): 3.1e-17,(36.4% identity in 151 aa overlap); Q9KD36|BH1383 from Bacillus halodurans (164 aa) FASTA scores: opt: 305, E(): 2.4e-12, (33.55% identity in 164 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3968272 | 3968760 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3614c|Mb3614c
MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
Bibliography
No article yet recorded