Gene Mb3619c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | beta-carbonic anhydrase canb |
| Comments | Mb3619c, -, len: 207 aa. Equivalent to Rv3588c,len: 207 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 207 aa overlap). Probable carbonic anhydrase (EC 4.2.1.1), equivalent to Q9CBJ1|ML1919 PUTATIVE CARBONIC ANHYDRASE from Mycobacterium leprae (213 aa), FASTA scores: opt: 1160, E(): 3.1e-66, (84.55% identity in 207 aa overlap). Also similar to many e.g. Q9X903|SCH35.03 from Streptomyces coelicolor (207 aa),FASTA scores: opt: 689, E(): 1.6e-36, (53.85% identity in 195 aa overlap); Q9RS89|DR2238 from Deinococcus radiodurans (264 aa), FASTA scores: opt: 451, E(): 2e-21,(39.7% identity in 189 aa overlap); Q39589|BETA-CA1 from Chlamydomonas reinhardtii (267 aa) FASTA scores: opt: 419,E(): 2.1e-19, (36.55% identity in 197 aa overlap); etc. Contains PS00704 and PS00705 Prokaryotic-type carbonic anhydrases signature 1 and 2. BELONGS TO THE PLANT AND PROKARYOTIC CARBONIC ANHYDRASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3973086 | 3973709 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3619c|canb
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVTDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV
Bibliography
No article yet recorded
