Gene Rv3588c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyzes reversible dehydration of CO2 to form bicarbonate |
| Product | Beta-carbonic anhydrase CanB |
| Comments | Rv3588c, (MTV024.06c), len: 207 aa. CanB, Beta-carbonic anhydrase, proven biochemically (See Suarez Covarrubias et al. 2005) similar to others e.g. Q9CBJ1|ML1919 putative carbonic anhydrase from Mycobacterium leprae (213 aa), FASTA scores: opt: 1160, E(): 3.1e-66, (84.55% identity in 207 aa overlap). Also similar to many e.g. Q9X903|SCH35.03 from Streptomyces coelicolor (207 aa), FASTA scores: opt: 689, E(): 1.6e-36, (53.85% identity in 195 aa overlap); Q9RS89|DR2238 from Deinococcus radiodurans (264 aa), FASTA scores: opt: 451, E(): 2e-21, (39.7% identity in 189 aa overlap); Q39589|beta-CA1 from Chlamydomonas reinhardtii (267 aa) FASTA scores: opt: 419, E(): 2.1e-19, (36.55% identity in 197 aa overlap); etc. Contains PS00704 and PS00705 Prokaryotic-type carbonic anhydrases signature 1 and 2. Belongs to the plant and prokaryotic carbonic anhydrase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4029871 | 4030494 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3588c|canB
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV
Bibliography
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Suarez Covarrubias A et al. [2005]. Structure and function of carbonic anhydrases from Mycobacterium tuberculosis. Biochemistry
- Covarrubias AS et al. [2006]. Structural mechanics of the pH-dependent activity of beta-carbonic anhydrase from Mycobacterium tuberculosis. Structure
- Mukherjee S et al. [2009]. Differential chemical and thermal unfolding pattern of Rv3588c and Rv1284 of Mycobacterium tuberculosis - A comparison by fluorescence and circular dichroism spectroscopy. Biophysics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant