Gene Mb3628c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | iron-regulated h-ns-like protein lsr2 |
Comments | Mb3628c, lsr2, len: 112 aa. Equivalent to Rv3597c,len: 112 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 112 aa overlap). Probable lsr2,identical to P24094|LSR2_MYCLE|ML0234 LSR2 PROTEIN PRECURSOR (15 KDA ANTIGEN) (A15) from Mycobacterium leprae (112 aa), FASTA scores: opt: 698, E(): 6.7e-37, (92.85% identity in 112 aa overlap). Also highly similar to others e.g. Q9X8N1|SCE94.26c from Streptomyces coelicolor (111 aa), FASTA scores: opt: 379, E(): 4.4e-17, (58.05% identity in 112 aa overlap); Q9ETI2|LSR2 from Corynebacterium equii (Rhodococcus equi) (119 aa), FASTA scores: opt: 328, E(): 6.9e-14, (47.5% identity in 120 aa overlap); and Q9RKK8|SCD25.12c from Streptomyces coelicolor (105 aa), FASTA scores: opt: 293, E(): 9.4e-12,(47.75% identity in 111 aa overlap). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3984222 | 3984560 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3628c|lsr2 MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT
Bibliography
No article yet recorded