Gene Mb3644c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 secretion-associated protein espd |
| Comments | Mb3644c, -, len: 184 aa. Equivalent to Rv3614c,len: 184 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 184 aa overlap). Conserved hypothetical protein, equivalent to Q49730|ML0407|B1620_C3_264|MLCL383.03 HYPOTHETICAL 24.2 KDA PROTEIN from Mycobacterium leprae (216 aa) FASTA scores: opt: 899, E(): 1.7e-51, (71.3% identity in 188 aa overlap); and similar to two hypothetical proteins from Mycobacterium leprae: Q9CDD6|ML0056 (169 aa), FASTA scores: opt: 285, E(): 1.2e-11, (38.35% identity in 172 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 289, E(): 1.2e-11, (38.95% identity in 172 aa overlap). Also highly similar to O69732|Rv3867|MTV027.02 HYPOTHETICAL 19.9 KDA PROTEIN from Mycobacterium tuberculosis (183 aa), FASTA scores: opt: 563, E(): 1e-29,(54.9% identity in 173 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3997272 | 3997826 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3644c|espd
MDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQEIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVALLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
Bibliography
No article yet recorded
