Gene Rv3614c (snm10)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | ESX-1 secretion-associated protein EspD |
| Comments | Rv3614c, (MTCY07H7B.08), len: 184 aa. EspD, ESX-1 secretion-associated protein, equivalent to Q49730|ML0407|B1620_C3_264|MLCL383.03 hypothetical 24.2 KDA protein from Mycobacterium leprae (216 aa) FASTA scores: opt: 899, E(): 1.7e-51, (71.3% identity in 188 aa overlap); and similar to two hypothetical proteins from Mycobacterium leprae: Q9CDD6|ML0056 (169 aa), FASTA scores: opt: 285, E(): 1.2e-11, (38.35% identity in 172 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 289, E(): 1.2e-11, (38.95% identity in 172 aa overlap). Also highly similar to O69732|Rv3867|MTV027.02 hypothetical 19.9 KDA protein from Mycobacterium tuberculosis (183 aa), FASTA scores: opt: 563, E(): 1e-29, (54.9% identity in 173 aa overlap). Rv3614c and Rv3882c interact, by yeast two-hybrid analysis (See MacGurn et al., 2005). EspD|Rv3614c is still secreted by M. tuberculosis H37Rv and Erdman ESX-1 secretion system mutants, but at levels lower than in wild-type (See Chen et al., 2012). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman Rv3615c transposon mutant had decreased expression of Rv3615c and Rv3614c and exhibited a secretion defect; mutant failed to grow in bone marrow-derived macrophages (See MacGurn et al., 2005). EspD|Rv3614c expression but not secretion is required for EsxA|Rv3875 secretion; EspD|Rv3614c stabilizes EspA|Rv3616c and EspC|Rv3615c (See Chen et al., 2012). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4054142 | 4054696 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3614c|espD
VDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQEIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVALLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- MacGurn JA et al. [2005]. A non-RD1 gene cluster is required for Snm secretion in Mycobacterium tuberculosis. Biochemistry Mutant
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Transcriptome
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Chen JM et al. [2012]. EspD is critical for the virulence-mediating ESX-1 secretion system in Mycobacterium tuberculosis. Biochemistry Mutant Operon
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant