Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductESX-1 secretion-associated protein EspD
CommentsRv3614c, (MTCY07H7B.08), len: 184 aa. EspD, ESX-1 secretion-associated protein, equivalent to Q49730|ML0407|B1620_C3_264|MLCL383.03 hypothetical 24.2 KDA protein from Mycobacterium leprae (216 aa) FASTA scores: opt: 899, E(): 1.7e-51, (71.3% identity in 188 aa overlap); and similar to two hypothetical proteins from Mycobacterium leprae: Q9CDD6|ML0056 (169 aa), FASTA scores: opt: 285, E(): 1.2e-11, (38.35% identity in 172 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 289, E(): 1.2e-11, (38.95% identity in 172 aa overlap). Also highly similar to O69732|Rv3867|MTV027.02 hypothetical 19.9 KDA protein from Mycobacterium tuberculosis (183 aa), FASTA scores: opt: 563, E(): 1e-29, (54.9% identity in 173 aa overlap). Rv3614c and Rv3882c interact, by yeast two-hybrid analysis (See MacGurn et al., 2005). EspD|Rv3614c is still secreted by M. tuberculosis H37Rv and Erdman ESX-1 secretion system mutants, but at levels lower than in wild-type (See Chen et al., 2012).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman Rv3615c transposon mutant had decreased expression of Rv3615c and Rv3614c and exhibited a secretion defect; mutant failed to grow in bone marrow-derived macrophages (See MacGurn et al., 2005). EspD|Rv3614c expression but not secretion is required for EsxA|Rv3875 secretion; EspD|Rv3614c stabilizes EspA|Rv3616c and EspC|Rv3615c (See Chen et al., 2012).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40541424054696-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3614c|espD
VDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQEIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVALLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
      
Bibliography