Gene Mb3647
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED LIPOPROTEIN LPQG |
| Comments | Mb3647, lpqG, len: 171 aa. Equivalent to 3' end of Rv3623, len: 240 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 171 aa overlap). Probable lpqG, conserved lipoprotein, showing some similarity with hypothetical proteins e.g. Q57432 from Methanosarcina barkeri (251 aa), FASTA scores: opt: 319,E(): 6.8e-12, (31.2% identity in 218 aa overlap); Q9PEA5|XF1123 OUTER MEMBRANE PROTEIN from Xylella fastidiosa (242 aa) FASTA scores: opt: 312, E(): 1.7e-11,(28.25% identity in 237 aa overlap); BAB49547|MLR2408 HYPOTHETICAL PROTEIN from Rhizobium loti (Mesorhizobium loti) (236 aa), FASTA scores: opt: 304, E(): 5e-11,(27.05% identity in 244 aa overlap); etc. Has suitable signal peptide and prokaryotic membrane lipoprotein lipid attachment site (PS00013). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large 5894 bp deletion leads to a shorter product with a different NH2 part compared to its homolog in Mycobacterium tuberculosis strain H37Rv (171 aa versus 240 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3999971 | 4000486 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3647|lpqG
MNQTNDRQQAVIDALVGAGLDRKDIRTTRVTVAPQYSNPEPAGTATITGYRADNDIEVKIHPTDAASRLLALVVSTGGDATRISSVSYSIGDDSQLVKDARARAFQDAKNRADQYAQLSGLRLGKVISISEASGAAPTHEAPAPPRGLSAVPLEPGQQTVGFSVTVVWELT
Bibliography
No article yet recorded