Gene Rv3623
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LpqG |
| Comments | Rv3623, (MTCY15C10.29c), len: 240 aa. Probable lpqG, conserved lipoprotein, showing some similarity with hypothetical proteins e.g. Q57432 from Methanosarcina barkeri (251 aa), FASTA scores: opt: 319, E(): 6.8e-12, (31.2% identity in 218 aa overlap); Q9PEA5|XF1123 outer membrane protein from Xylella fastidiosa (242 aa) FASTA scores: opt: 312, E(): 1.7e-11, (28.25% identity in 237 aa overlap); BAB49547|MLR2408 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (236 aa), FASTA scores: opt: 304, E(): 5e-11, (27.05% identity in 244 aa overlap); etc. Has suitable signal peptide and prokaryotic membrane lipoprotein lipid attachment site (PS00013). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4062527 | 4063249 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3623|lpqG
MIRLVRHSIALVAAGLAAALSGCDSHNSGSLGADPRQVTVFGSGQVQGVPDTLIADVGIQVTAADVTSAMNQTNDRQQAVIDALVGAGLDRKDIRTTRVTVAPQYSNPEPAGTATITGYRADNDIEVKIHPTDAASRLLALVVSTGGDATRISSVSYSIGDDSQLVKDARARAFQDAKNRADQYAQLSGLRLGKVISISEASGAAPTHEAPAPPRGLSAVPLEPGQQTVGFSVTVVWELT
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
