Gene Mb3660
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible transposase |
| Comments | Mb3660, -, len: 115 aa. Equivalent to Rv3636, len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 115 aa overlap). Possible transposase,weakly similar to others e.g. O69924|SC3C8.12 PUTATIVE TRANSPOSASE from Streptomyces coelicolor (487 aa) FASTA scores: opt: 132, E(): 0.12, (33.05% identity in 112 aa overlap); O96916 TC1-LIKE TRANSPOSASE from Anopheles gambiae (African malaria mosquito) (332 aa), FASTA scores: opt: 117, E(): 0.84, (30.75% identity in 91 aa overlap); Q9R2U5|IS466A|IS466A-ORF|TNPA|IS469|SCP1.276 TRANSPOSASE (INSERTION ELEMENT IS466S TRANSPOSASE) from Streptomyces coelicolor (513 aa), FASTA scores: opt: 114, E(): 2,(30.5% identity in 82 aa overlap); etc. Similar in part to P96288|Rv2943|MTCY24G1.06c HYPOTHETICAL 45.8 KDA PROTEIN from Mycobacterium tuberculosis (413 aa), FASTA scores: opt: 533, E(): 1.4e-28, (74.55% identity in 110 aa overlap). Contains possible helix-turn-helix motif from aa 19-40 (+4.98 SD). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4012989 | 4013336 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3660|Mb3660
MLSVEDWAEIRRLRRSERLPISEIARVLKISRNTVKSALASDGPPKYQRAAKGSVADEAEPRIRELLAAYPRMPATVIAERIGWWYSIRTLSGRVRELRPLYLPPDPASRDICGR
Bibliography
No article yet recorded
