Gene Rv3636
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of an insertion element. |
| Product | Possible transposase |
| Comments | Rv3636, (MTCY15C10.16c), len: 115 aa. Possible transposase, weakly similar to others e.g. O69924|SC3C8.12 putative transposase from Streptomyces coelicolor (487 aa) FASTA scores: opt: 132, E(): 0.12, (33.05% identity in 112 aa overlap); O96916 TC1-like transposase from Anopheles gambiae (African malaria mosquito) (332 aa), FASTA scores: opt: 117, E(): 0.84, (30.75% identity in 91 aa overlap); Q9R2U5|IS466A|IS466A-ORF|TNPA|IS469|SCP1.276 transposase (insertion element IS466S transposase) from Streptomyces coelicolor (513 aa), FASTA scores: opt: 114, E(): 2, (30.5% identity in 82 aa overlap); etc. Similar in part to P96288|Rv2943|MTCY24G1.06c hypothetical 45.8 KDA protein from Mycobacterium tuberculosis (413 aa), FASTA scores: opt: 533, E(): 1.4e-28, (74.55% identity in 110 aa overlap). Contains possible helix-turn-helix motif from aa 19-40 (+4.98 SD). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4075752 | 4076099 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3636|Rv3636
VLSVEDWAEIRRLRRSERLPISEIARVLKISRNTVKSALASDGPPKYQRAAKGSVADEAEPRIRELLAAYPRMPATVIAERIGWWYSIRTLSGRVRELRPLYLPPDPASRDICGR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
