Gene Mb3674
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe33 |
| Comments | Mb3674, PE33, len: 94 aa. Equivalent to Rv3650,len: 94 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 94 aa overlap). Short protein, member of the Mycobacterium tuberculosis PE family, but without the repetitive gly-rich region, similar to the N-terminal part of many e.g. O53809|Rv0746|MTV041.20 PGRS-FAMILY PROTEIN (783 aa), FASTA scores: opt: 363, E(): 2.1e-15,(76.55% identity in 81 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4028470 | 4028754 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3674|PE33
MSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQAYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR
Bibliography
No article yet recorded