Gene Rv3650
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE33 |
| Comments | Rv3650, (MTCY15C10.02c), len: 94 aa. PE33, Short protein, member of the Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), but without the repetitive gly-rich region, similar to the N-terminal part of many e.g. O53809|Rv0746|MTV041.20 PGRS-family protein (783 aa), FASTA scores: opt: 363, E(): 2.1e-15, (76.55% identity in 81 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4091233 | 4091517 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3650|PE33
VSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQAYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant