Gene Mb3676
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe-pgrs family-related protein pe_pgrs60 |
| Comments | Mb3676, PE_PGRS60, len: 104 aa. Equivalent to Rv3652, len: 104 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 104 aa overlap). Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, similar at N-terminal end with many e.g. P56877|Y278_MYCTU|Rv0278c|MTV035.06c (957 aa) FASTA scores: opt: 242, E(): 3e-09, (77.35% identity in 53 aa overlap). Originally annotated as the first part of a PE-PGRS family protein (Rv3653/PE_PGRS61 being the second part) but more similar to a PE family protein. Length extended since first submission (+50 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4030869 | 4031183 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3676|PE_PGRS60
MSYVIAAPEALVAAATDLATLGSTIGAANAAAAGSTTALLTAGADEVSAAIAAYSECTARPIRHSVRGRRRSMSGSCRPWPQVGAPMRPPRPPASRRCRARSIC
Bibliography
No article yet recorded