Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE-PGRS family-related protein PE_PGRS60
CommentsRv3652, (MTV025.001A), len: 104 aa. PE_PGRS60, Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see Brennan and Delogu, 2002), similar at N-terminal end with many e.g. P56877|Y278_MYCTU|Rv0278c|MTV035.06c (957 aa) FASTA scores: opt: 242, E(): 3e-09, (77.35% identity in 53 aa overlap). Originally annotated as the first part of a PE-PGRS family protein (Rv3653/PE_PGRS61 being the second part) but more similar to a PE family protein. Length extended since first submission (+50 aa).
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40936324093946+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3652|PE_PGRS60
MSYVIAAPEALVAAATDLATLGSTIGAANAAAAGSTTALLTAGADEVSAAIAAYSECTARPIRHSVRGRRRSMSGSCRPWPQVGAPMRPPRPPASRRCRARSIC