Gene Rv3652
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family-related protein PE_PGRS60 |
| Comments | Rv3652, (MTV025.001A), len: 104 aa. PE_PGRS60, Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see Brennan and Delogu, 2002), similar at N-terminal end with many e.g. P56877|Y278_MYCTU|Rv0278c|MTV035.06c (957 aa) FASTA scores: opt: 242, E(): 3e-09, (77.35% identity in 53 aa overlap). Originally annotated as the first part of a PE-PGRS family protein (Rv3653/PE_PGRS61 being the second part) but more similar to a PE family protein. Length extended since first submission (+50 aa). |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4093632 | 4093946 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3652|PE_PGRS60
MSYVIAAPEALVAAATDLATLGSTIGAANAAAAGSTTALLTAGADEVSAAIAAYSECTARPIRHSVRGRRRSMSGSCRPWPQVGAPMRPPRPPASRRCRARSIC
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
