Gene Mb3677
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe-pgrs family-related protein pe_pgrs61 |
| Comments | Mb3677, PE_PGRS61, len: 237 aa. Similar to Rv3653,len: 195 aa, from Mycobacterium tuberculosis strain H37Rv,(82.2% identity in 237 aa overlap). Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, highly similar to the C-termini of members of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, e.g. MTCY1A11_25,MTCY28_25, MTCY130_10, MTCY1A10_19, MTCY21B4_13,MTCI418B_6,MTCY28_34, MTV004_1, MTCY441_4; etc. Originally annotated as the second part of a PE-PGRS family protein (Rv3652/PE_PGRS60 being the first part). Start shortened since first submission (-50 aa). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a frameshift due to an in-frame insertion of 126 bp leads to a longer product than in Mycobacterium tuberculosis strain H37Rv, (237 aa versus 195 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4031177 | 4031890 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3677|PE_PGRS61
MLNAPTQALLGRPLVGNGANGAPGTGANGGDGGILFGSGGAGGSGAAGMAGGNGGAAGLFGNGGAGGAGGSATAGAAGAGGNGGAGGLLFGTAGAGGNGGLSLGLGVAGGAGGAGGSGGSDTAGHGGTGGAGGLLFGAGGAGGAGGLGGFRGAGGTGGAGGDGGNAGLFGDGGAGGAGGAGEDGTTPGGNGGAGGVAGLFGDGGNGGNAGVGTPAGNVGAGGTGGLLLGQDGMTGLT
Bibliography
No article yet recorded
