Gene Rv3653
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family-related protein PE_PGRS61 |
| Comments | Rv3653, (MTV025.001B), len: 195 aa. PE_PGRS61, Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see Brennan and Delogu, 2002), highly similar to the C-termini of members of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, e.g. MTCY1A11_25, MTCY28_25, MTCY130_10, MTCY1A10_19, MTCY21B4_13, MTCI418B_6,MTCY28_34, MTV004_1, MTCY441_4; etc. Originally annotated as the second part of a PE-PGRS family protein (Rv3652/PE_PGRS60 being the first part). Start shortened since first submission (-50 aa). |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4093940 | 4094527 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3653|PE_PGRS61
LLNAPTQALLGRPLVGNGANGAPGTGANGGDGGILFGSGGAGGSGAAGMAGGNGGAAGLFGNGGAGGAGGSATAGAAGAGGNGGAGGLLFGTAGAGGNGGLSLGLGVAGGAGGAGGSGGSDTAGHGGTGGAGGLLFGAGEDGTTPGGNGGAGGVAGLFGDGGNGGNAGVGTPAGNVGAGGTGGLLLGQDGMTGLT
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
