Gene Mb3706c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable transcriptional regulatory protein whib-like whib4 |
| Comments | Mb3706c, whiB4, len: 118 aa. Equivalent to Rv3681c,len: 118 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 118 aa overlap). Probable whiB4,WhiB-like regulatory protein (see citation below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Equivalent to ML2307 HYPOTHETICAL PROTEIN from Mycobacterium leprae (116 aa). Also highly similar to Q9S2B9|SCH17.13c PUTATIVE REGULATORY PROTEIN from Streptomyces coelicolor (112 aa), FASTA scores: opt: 392,E(): 1e-20, (67.95% identity in 78 aa overlap); Q9X951|WBLA HYPOTHETICAL 14.3 KDA PROTEIN from Streptomyces coelicolor (129 aa), FASTA scores: opt: 392,E(): 1.1e-20, (67.95% identity in 78 aa overlap); Q9ACZ0|SCP1.161c PUTATIVE REGULATORY PROTEIN from Streptomyces coelicolor (268 aa), FASTA scores: opt: 273,E(): 4.4e-12, (50.0% identity in 78 aa overlap); Q06387|WHIB-STV from Streptomyces griseocarneus (87 aa) FASTA scores: opt: 231, E(): 1.5e-09, (43.85% identity in 73 aa overlap); etc. Also similar to several putative regulator proteins from Mycobacterium tuberculosis e.g. MTCY7D11_7; MTCY78_13; MTCY10H4_23; MTCY1A6_6; and U00016_29 from M. leprae. N-terminus shortened since first submission. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4058545 | 4058901 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3706c|whiB4
MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG
Bibliography
No article yet recorded
