Gene Rv3681c (whmA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in a transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein WhiB-like WhiB4 |
| Comments | Rv3681c, (MTV025.029c), len: 118 aa. Probable whiB4 (alternate gene name: whmA), WhiB-like regulatory protein (see Hutter & Dick 1999), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Equivalent to ML2307 hypothetical protein from Mycobacterium leprae (116 aa). Also highly similar to Q9S2B9|SCH17.13c putative regulatory protein from Streptomyces coelicolor (112 aa), FASTA scores: opt: 392, E(): 1e-20, (67.95% identity in 78 aa overlap); Q9X951|WBLA hypothetical 14.3 KDA protein from Streptomyces coelicolor (129 aa), FASTA scores: opt: 392, E(): 1.1e-20, (67.95% identity in 78 aa overlap); Q9ACZ0|SCP1.161c putative regulatory protein from Streptomyces coelicolor (268 aa), FASTA scores: opt: 273, E(): 4.4e-12, (50.0% identity in 78 aa overlap); Q06387|WHIB-STV from Streptomyces griseocarneus (87 aa) FASTA scores: opt: 231, E(): 1.5e-09, (43.85% identity in 73 aa overlap); etc. Also similar to several putative regulator proteins from Mycobacterium tuberculosis e.g. MTCY7D11_7; MTCY78_13; MTCY10H4_23; MTCY1A6_6; and U00016_29 from Mycobacterium leprae. N-terminus shortened since first submission. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4121198 | 4121554 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3681c|whiB4
VSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG
Bibliography
- Hutter B and Dick T [1999]. Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor. Homolog Mutant
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
