Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productanti-anti-sigma factor rsfb (anti-sigma factor antagonist) (regulator of sigma f b)
CommentsMb3712c, -, len: 81 aa. Equivalent to Rv3687c, len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Hypothetical protein,showing some similarity to sporulation proteins and sigma-factor genes e.g. Q9WVX8|RSBV_STRCO|BLDG|SCH5.12c ANTI-SIGMA B FACTOR ANTAGONIST from Streptomyces coelicolor (113 aa) FASTA scores: opt: 163, E(): 0.0007,(31.15% identity in 106 aa overlap); Q9F3A2|SC5F1.27c PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST from Streptomyces coelicolor (114 aa) FASTA scores: opt: 159, E(): 0.0013,(29.8% identity in 104 aa overlap); P73609|SLR1859 HYPOTHETICAL 12.0 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (108 aa) FASTA scores: opt: 152, E(): 0.0034, (32.2% identity in 90 aa overlap); L47358|BACSPOI_1 spoIIA A from Paenibacillus polymyxa (117 aa), FASTA scores: opt: 107, E(): 0.23, (24.8% identity in 113 aa overlap); SQSIGB_4 rsbU, rsbV, rsbW & sigB genes from Steptomyces aureus (108 aa) (28.3% identity in 60 aa overlap); etc. Also similar to hypothetical proteins from Mycobacterium tuberculosis e.g. MTCY180_14 and MTCY441 _8. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis,truncation at the 5' start due to a single base transversion (g-t) leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (81 aa versus 122 aa).
Functional categoryInformation pathways
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40666704066915-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3712c|rsfb
MADNPTALVIDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRIDR
      
Bibliography
No article yet recorded