Gene Rv3687c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Regulates negatively Rv3287c|RSBW|USFX. Possibly regulated by phosphorylation. |
| Product | Anti-anti-sigma factor RsfB (anti-sigma factor antagonist) (regulator of sigma F B) |
| Comments | Rv3687c, (MTV025.035c), len: 122 aa. RsfB, anti-anti-sigma factor (see citation below), showing some similarity to sporulation proteins and sigma-factor genes e.g. Q9WVX8|RSBV_STRCO|bldg|SCH5.12c anti-sigma B factor antagonist from Streptomyces coelicolor (113 aa) FASTA scores: opt: 163, E(): 0.0007, (31.15% identity in 106 aa overlap); Q9F3A2|SC5F1.27c putative anti-sigma factor antagonist from Streptomyces coelicolor (114 aa) FASTA scores: opt: 159, E(): 0.0013, (29.8% identity in 104 aa overlap); P73609|SLR1859 hypothetical 12.0 KDA protein from Synechocystis sp. strain PCC 6803 (108 aa) FASTA scores: opt: 152, E(): 0.0034, (32.2% identity in 90 aa overlap); L47358|BACSPOI_1 spoIIA a from Paenibacillus polymyxa (117 aa), FASTA scores: opt: 107, E(): 0.23, (24.8% identity in 113 aa overlap); SQSIGB_4 rsbU, rsbV, rsbW & sigB genes from Steptomyces aureus (108 aa) (28.3% identity in 60 aa overlap); etc. Also similar to hypothetical proteins from Mycobacterium tuberculosis e.g. MTCY180_14 and MTCY441 _8. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4129323 | 4129691 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3687c|rsfB
LSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRIDR
Bibliography
- Beaucher J et al. [2002]. Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Product Function Regulation Mutant
- Parida BK et al. [2005]. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Biochemistry
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
