Gene Mb3731c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3731c, -, len: 214 aa. Equivalent to Rv3705c,len: 214 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 214 aa overlap). Conserved hypothetical protein, equivalent to Q9CB80|ML2320 HYPOTHETICAL PROTEIN from Mycobacterium leprae (215 aa) FASTA scores: opt: 1145, E(): 5.9e-68, (79.45% identity in 214 aa overlap). Some similarity to the C-terminal end of Q11053|PKNH_MYCTU|Rv1266c|MT1304|MTCY50.16 PROBABLE SERINE/THREONINE-PROTEIN from Mycobacterium tuberculosis (626 aa), FASTA scores: opt: 175, E(): 0.0005, (24.9% identity in 201 aa overlap); and to the N-terminal end of P23903|E13B_BACCI|GLCA GLUCAN ENDO-1,3-BETA-GLUCOSIDASE A1 PRECURSOR from Bacillus circulans (682 aa), FASTA scores: opt: 122, E(): 1.6, (25.6% identity in 164 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4085666 | 4086310 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3731c|Mb3731c
MRIAAAVVSIGLAVIAGFAVPVADAHPSEPGVVSYAVLGKGSVGNIVGAPMGWEAVFTRPFQAFWVELPACNNWVDIGLPEVYDDPDLASFNGATTQTSATDQTHLVKQAVGVFASNDAADRAFHRVVDRTVGCSGQTTAIHLDDGTTQVWSFAGGPSTGTDEAWTKQEAGTDRRCFVQTRLRENVLLQAKVCQSGNAGPAVNVLAGAMQNTLG
Bibliography
No article yet recorded