Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3705c, (MTV025.053c), len: 214 aa. Conserved protein, equivalent to Q9CB80|ML2320 hypothetical protein from Mycobacterium leprae (215 aa) FASTA scores: opt: 1145, E(): 5.9e-68, (79.45% identity in 214 aa overlap). Some similarity to the C-terminal end of Q11053|PKNH_MYCTU|Rv1266c|MT1304|MTCY50.16 probable serine/threonine-protein from Mycobacterium tuberculosis (626 aa), FASTA scores: opt: 175, E(): 0.0005, (24.9% identity in 201 aa overlap); and to the N-terminal end of P23903|E13B_BACCI|GLCA glucan endo-1,3-beta-glucosidase A1 precursor from Bacillus circulans (682 aa), FASTA scores: opt: 122, E(): 1.6, (25.6% identity in 164 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryConserved hypotheticals
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41483184148962-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3705c|Rv3705c
MRIAAAVVSIGLAVIAGFAVPVADAHPSEPGVVSYAVLGKGSVGNIVGAPMGWEAVFTRPFQAFWVELPACNNWVDIGLPEVYDDPDLASFNGATTQTSATDQTHLVKQAVGVFASNDAADRAFHRVVDRTVGCSGQTTAIHLDDGTTQVWSFAGGPSTGTDEAWTKQEAGTDRRCFVQTRLRENVLLQAKVCQSGNAGPAVNVLAGAMQNTLG
      
Bibliography