Gene Mb3743c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3743c, -, len: 133 aa. Equivalent to Rv3716c,len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Conserved hypothetical protein, equivalent to O69519|Y1B6_MYCLE|ML2330|MLCB2407.20 HYPOTHETICAL 11.9 KDA PROTEIN from Mycobacterium leprae (116 aa), FASTA scores: opt: 616, E(): 2.6e-21, (84.55% identity in 110 aa overlap). Also highly similar to hypothetical ~12 kDa proteins in the vicinity of recR from other bacteria e.g. Q9XAI3|YT3D_STRCO|SC66T3.30c HYPOTHETICAL 11.7 KDA PROTEIN from Streptomyces coelicolor (115 aa), FASTA scores: opt: 379, E(): 9.5e-11, (50.8% identity in 122 aa overlap); BAB56641|SAV0479 CONSERVED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (105 aa) FASTA scores: opt: 295, E(): 4.9e-07, (41.75% identity in 103 aa overlap); Q99WC4P24281|YAAK_BACSU HYPOTHETICAL 11.8 KDA PROTEIN IN DNAZ-RECR INTERGENIC REGION from Bacillus subtilis (107 aa), FASTA scores: opt: 272, E(): 5.3e-06,(39.4% identity in 104 aa overlap); P17577|YBAB_ECOLI|B0471|Z0588|ECS0524 from Escherichia coli strain K and O157:H7 (109 aa), FASTA scores: opt: 256, E(): 2.8e-05, (38.0% identity in 100 aa overlap); etc. Contains probable coiled-coil domain from aa 1-40. SEEMS TO BELONG TO THE UPF0133 FAMILY. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4097972 | 4098373 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3743c|Mb3743c
MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI
Bibliography
No article yet recorded