Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productconserved protein
CommentsMb3743c, -, len: 133 aa. Equivalent to Rv3716c,len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Conserved hypothetical protein, equivalent to O69519|Y1B6_MYCLE|ML2330|MLCB2407.20 HYPOTHETICAL 11.9 KDA PROTEIN from Mycobacterium leprae (116 aa), FASTA scores: opt: 616, E(): 2.6e-21, (84.55% identity in 110 aa overlap). Also highly similar to hypothetical ~12 kDa proteins in the vicinity of recR from other bacteria e.g. Q9XAI3|YT3D_STRCO|SC66T3.30c HYPOTHETICAL 11.7 KDA PROTEIN from Streptomyces coelicolor (115 aa), FASTA scores: opt: 379, E(): 9.5e-11, (50.8% identity in 122 aa overlap); BAB56641|SAV0479 CONSERVED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (105 aa) FASTA scores: opt: 295, E(): 4.9e-07, (41.75% identity in 103 aa overlap); Q99WC4P24281|YAAK_BACSU HYPOTHETICAL 11.8 KDA PROTEIN IN DNAZ-RECR INTERGENIC REGION from Bacillus subtilis (107 aa), FASTA scores: opt: 272, E(): 5.3e-06,(39.4% identity in 104 aa overlap); P17577|YBAB_ECOLI|B0471|Z0588|ECS0524 from Escherichia coli strain K and O157:H7 (109 aa), FASTA scores: opt: 256, E(): 2.8e-05, (38.0% identity in 100 aa overlap); etc. Contains probable coiled-coil domain from aa 1-40. SEEMS TO BELONG TO THE UPF0133 FAMILY.
Functional categoryConserved hypotheticals
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40979724098373-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3743c|Mb3743c
MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI
      
Bibliography
No article yet recorded