Gene Mb3770
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | metal sensor transcriptional regulator (arsr-smtb family) |
| Comments | Mb3770, -, len: 120 aa. Equivalent to Rv3744, len: 120 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 120 aa overlap). Probable transcriptional regulator, possible arsR family, highly similar to many e.g. Q9ZBF4|SC9B5.26c from Streptomyces coelicolor (120 aa), FASTA scores: opt: 480, E(): 2.4e-24,(63.25% identity in 117 aa overlap); O31844|YOZA YOZA REGULATOR from Bacillus subtilis (107 aa), FASTA scores: opt: 249, E(): 1.6e-09, (44.8% identity in 96 aa overlap); P30340|SMTB_SYNP7|SMTB from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (122 aa), FASTA scores: opt: 230, E(): 2.9e-08, (46.0% identity in 87 aa overlap); etc. Equivalent to AAK48216 from Mycobacterium tuberculosis strain CDC1551 (135 aa) but shorter 15 aa. Also similar to MTCY27_22; MTCY39_25; and MTCY441_12. Contains helix-turn-helix motif at aa 47-68 (Score 1815, +5.37 SD). SEEMS TO BELONG TO THE ARSR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4131734 | 4132096 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3770|nmtr
MGHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG
Bibliography
No article yet recorded
