Gene Rv3744
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Represses transcription from the NMTA operator-promoter. Repression is alleviated by NI(II) or co(II). |
| Product | Metal sensor transcriptional regulator (ArsR-SmtB family) |
| Comments | Rv3744, (MTV025.092), len: 120 aa. Transcriptional regulator nmtR (See Cavet et al., 2002). Highly similar to many e.g. Q9ZBF4|SC9B5.26c from Streptomyces coelicolor (120 aa), FASTA scores: opt: 480, E(): 2.4e-24, (63.25% identity in 117 aa overlap); O31844|YOZA YOZA regulator from Bacillus subtilis (107 aa), FASTA scores: opt: 249, E(): 1.6e-09, (44.8% identity in 96 aa overlap); P30340|SMTB_SYNP7|SMTB from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (122 aa), FASTA scores: opt: 230, E(): 2.9e-08, (46.0% identity in 87 aa overlap); etc. Equivalent to AAK48216 from Mycobacterium tuberculosis strain CDC1551 (135 aa) but shorter 15 aa. Also similar to MTCY27_22; MTCY39_25; and MTCY441_12. Contains helix-turn-helix motif at aa 47-68 (Score 1815, +5.37 SD). Belongs to the ArsR-SmtB family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4195440 | 4195802 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3744|nmtR
MGHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG
Bibliography
- Cavet JS et al. [2002]. A nickel-cobalt-sensing ArsR-SmtB family repressor. Contributions of cytosol and effector binding sites to metal selectivity. Function Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Campbell DR et al. [2007]. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
