Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionRepresses transcription from the NMTA operator-promoter. Repression is alleviated by NI(II) or co(II).
ProductMetal sensor transcriptional regulator (ArsR-SmtB family)
CommentsRv3744, (MTV025.092), len: 120 aa. Transcriptional regulator nmtR (See Cavet et al., 2002). Highly similar to many e.g. Q9ZBF4|SC9B5.26c from Streptomyces coelicolor (120 aa), FASTA scores: opt: 480, E(): 2.4e-24, (63.25% identity in 117 aa overlap); O31844|YOZA YOZA regulator from Bacillus subtilis (107 aa), FASTA scores: opt: 249, E(): 1.6e-09, (44.8% identity in 96 aa overlap); P30340|SMTB_SYNP7|SMTB from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (122 aa), FASTA scores: opt: 230, E(): 2.9e-08, (46.0% identity in 87 aa overlap); etc. Equivalent to AAK48216 from Mycobacterium tuberculosis strain CDC1551 (135 aa) but shorter 15 aa. Also similar to MTCY27_22; MTCY39_25; and MTCY441_12. Contains helix-turn-helix motif at aa 47-68 (Score 1815, +5.37 SD). Belongs to the ArsR-SmtB family of transcriptional regulators.
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41954404195802+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3744|nmtR
MGHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG