Gene Mb3772c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable pe family protein pe34 (pe family-related protein) |
Comments | Mb3772c, PE34, len: 111 aa. Equivalent to Rv3746c,len: 111 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 111 aa overlap). Probable member of the Mycobacterium tuberculosis PE family, but without the glycine-rich C-terminal part, similar to N-termini of many e.g. O69737|Rv3872|MTV027.07 (99 aa) FASTA scores: opt: 306, E(): 1e-13, (50.5% identity in 99 aa overlap); O53215|Rv2490c|MTV008.46 (1660 aa) FASTA scores: opt: 125,E(): 0.99, (34.25% identity in 111 aa overlap). Also weakly similar to MTV008_46; MTCI418B_6; MTCY130_1; MTY25D10_11; MTCY1A11_25; MTCY21B4_13; MTCY21B4_27; MTCY493_2; MTCY28_25; etc. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4132465 | 4132800 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3772c|PE34 MQSMSFDPAVADIGSQVVNNAFQGLQAGAVAWVSLSSLLPAGAEEVSAWAVTAFTTAATGLLALNQAAQEELRKAGEVFTAIARMYSDADVRAAACLLEAIPRPGQTLARE
Bibliography
No article yet recorded