Gene Rv3746c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Probable PE family protein PE34 (PE family-related protein) |
| Comments | Rv3746c, (MTV025.094c), len: 111 aa. PE34, Probable member of the Mycobacterium tuberculosis PE family (see citation below), but without the glycine-rich C-terminal part, similar to N-termini of many e.g. O69737|Rv3872|MTV027.07 (99 aa) FASTA scores: opt: 306, E(): 1e-13, (50.5% identity in 99 aa overlap); O53215|Rv2490c|MTV008.46 (1660 aa) FASTA scores: opt: 125, E(): 0.99, (34.25% identity in 111 aa overlap). Also weakly similar to MTV008_46; MTCI418B_6; MTCY130_1; MTY25D10_11; MTCY1A11_25; MTCY21B4_13; MTCY21B4_27; MTCY493_2; MTCY28_25; etc. |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4196171 | 4196506 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3746c|PE34
MQSMSFDPAVADIGSQVVNNAFQGLQAGAVAWVSLSSLLPAGAEEVSAWAVTAFTTAATGLLALNQAAQEELRKAGEVFTAIARMYSDADVRAAACLLEAIPRPGQTLARE
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG and Gordon SV [2008]. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
