Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductProbable PE family protein PE34 (PE family-related protein)
CommentsRv3746c, (MTV025.094c), len: 111 aa. PE34, Probable member of the Mycobacterium tuberculosis PE family (see citation below), but without the glycine-rich C-terminal part, similar to N-termini of many e.g. O69737|Rv3872|MTV027.07 (99 aa) FASTA scores: opt: 306, E(): 1e-13, (50.5% identity in 99 aa overlap); O53215|Rv2490c|MTV008.46 (1660 aa) FASTA scores: opt: 125, E(): 0.99, (34.25% identity in 111 aa overlap). Also weakly similar to MTV008_46; MTCI418B_6; MTCY130_1; MTY25D10_11; MTCY1A11_25; MTCY21B4_13; MTCY21B4_27; MTCY493_2; MTCY28_25; etc.
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41961714196506-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv3746c|4196171-4196506|-|PE34|downstream:0|upstream:0
atgcagtccatgtcattcgatccggccgttgccgacatcggatcgcaggtcgtcaacaacgcattccaagggctacaggccggtgcggtggcgtgggtctcgctgagctcgctattgcccgccggggccgaggaggtgtcggcgtgggcggtaacggcgttcacgacggcggccaccgggctgctggcgctgaatcaagcggcgcaggaagagctgagaaaggcgggcgaggtgtttaccgcgatcgcccggatgtattcggacgccgacgtcagggcggccgcctgcttgctcgaagcaattccgcgacccggccagaccctcgcgcgggaatag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3746c|PE34
MQSMSFDPAVADIGSQVVNNAFQGLQAGAVAWVSLSSLLPAGAEEVSAWAVTAFTTAATGLLALNQAAQEELRKAGEVFTAIARMYSDADVRAAACLLEAIPRPGQTLARE