Gene Mb3776c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible excisionase |
| Comments | Mb3776c, -, len: 130 aa. Equivalent to Rv3750c,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Possible excisionase,similar to others e.g. Q9LCU5 PUTATIVE EXCISIONASE from Arthrobacter sp. TM1 (174 aa) FASTA scores: opt: 297, E(): 1.2e-12, (40.35% identity in 114 aa overlap); O85865 PUTATIVE EXCISIONASE from Sphingomonas aromaticivorans plasmid pNL1 (152 aa), FASTA scores: opt: 223, E(): 7.3e-08, (39.15% identity in 97 aa overlap); Q9XBH1|XIS EXCISIONASE from Bacteroides fragilis (124 aa) FASTA scores: opt: 128, E(): 0.1, (30.7% identity in 88 aa overlap); etc. Also some similarity to transcriptional regulators. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. P71902|YN10_MYCTU|Rv2310|MT2372|MTCY3G12.24c (114 aa) FASTA scores: opt: 224, E(): 4.9e-08, (42.7% identity in 82 aa overlap). Contains helix-turn-helix motif at aa 55-76 (Score 1925,+5.74 SD). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4134500 | 4134892 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3776c|Mb3776c
MTSLLEVLGAPEVSVCGNAGQPMTLPEPVRDALYNVVLALSQGKGISLVPRHLKLTTQEAADLLNISRPTLVRLLEDGRIPFEKPGRHRRVSLDALLEYQQETRSNRRAALGELSRDALGELQAALAEKK
Bibliography
No article yet recorded
