Gene Rv3750c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sequence excision. |
| Product | Possible excisionase |
| Comments | Rv3750c, (MTV025.098c), len: 130 aa. Possible excisionase, similar to others e.g. Q9LCU5 putative excisionase from Arthrobacter sp. TM1 (174 aa) FASTA scores: opt: 297, E(): 1.2e-12, (40.35% identity in 114 aa overlap); O85865 putative excisionase from Sphingomonas aromaticivorans plasmid pNL1 (152 aa), FASTA scores: opt: 223, E(): 7.3e-08, (39.15% identity in 97 aa overlap); Q9XBH1|xis excisionase from Bacteroides fragilis (124 aa) FASTA scores: opt: 128, E(): 0.1, (30.7% identity in 88 aa overlap); etc. Also some similarity to transcriptional regulators. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. P71902|YN10_MYCTU|Rv2310|MT2372|MTCY3G12.24c (114 aa) FASTA scores: opt: 224, E(): 4.9e-08, (42.7% identity in 82 aa overlap). Contains helix-turn-helix motif at aa 55-76 (Score 1925,+5.74 SD). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4198205 | 4198597 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3750c|Rv3750c
MTSLLEVLGAPEVSVCGNAGQPMTLPEPVRDALYNVVLALSQGKGISLVPRHLKLTTQEAADLLNISRPTLVRLLEDGRIPFEKPGRHRRVSLDALLEYQQETRSNRRAALGELSRDALGELQAALAEKK
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
