Gene Mb3786
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE CONSERVED MEMBRANE PROTEIN |
| Comments | Mb3786, -, len: 100 aa. Equivalent to Rv3760, len: 100 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 100 aa overlap). Possible conserved membrane protein, equivalent to Q50094|ML2366|MLCB12.11c PUTATIVE MEMBRANE PROTEIN from Mycobacterium leprae (113 aa), FASTA scores: opt: 423, E(): 1.2e-20, (67.7% identity in 99 aa overlap). Also similar with Q9JST1|NMA2149 PUTATIVE INNER MEMBRANE HYPOTHETICAL PROTEIN from Neisseria meningitidis (serogroup A) (104 aa), FASTA scores: opt: 113, E(): 0.95, (33.85% identity in 62 aa overlap); and showing similarity with Q9ZAX7 ABC TRANSPORTER MEMBRANE PROTEIN SUBUNIT from Streptococcus mutans (498 aa), FASTA scores: opt: 108, E(): 6.7, (42.35% identity in 85 aa overlap) (similarity at C-terminus); and P33108|SECY_MICLU PREPROTEIN TRANSLOCASE SECY SUBUNIT from Micrococcus luteus (Micrococcus lysodeikticus) (436 aa),FASTA scores: opt: 106, E(): 8.2, (29.05% identity in 86 aa overlap). Equivalent to AAK48231 from Mycobacterium tuberculosis strain CDC1551 (117 aa) but shorter 17 aa. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4141832 | 4142134 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3786|Mb3786
MPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQNTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR
Bibliography
No article yet recorded