Gene Rv3760
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv3760, (MTV025.108), len: 100 aa. Possible conserved membrane protein, equivalent to Q50094|ML2366|MLCB12.11c putative membrane protein from Mycobacterium leprae (113 aa), FASTA scores: opt: 423, E(): 1.2e-20, (67.7% identity in 99 aa overlap). Also similar with Q9JST1|NMA2149 putative inner membrane hypothetical protein from Neisseria meningitidis (serogroup A) (104 aa), FASTA scores: opt: 113, E(): 0.95, (33.85% identity in 62 aa overlap); and showing similarity with Q9ZAX7 ABC transporter membrane protein subunit from Streptococcus mutans (498 aa), FASTA scores: opt: 108, E(): 6.7, (42.35% identity in 85 aa overlap) (similarity at C-terminus); and P33108|SECY_MICLU preprotein translocase SECY subunit from Micrococcus luteus (Micrococcus lysodeikticus) (436 aa), FASTA scores: opt: 106, E(): 8.2, (29.05% identity in 86 aa overlap). Equivalent to AAK48231 from Mycobacterium tuberculosis strain CDC1551 (117 aa) but shorter 17 aa. |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4205538 | 4205840 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3760|Rv3760
VPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQNTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant