Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productudp-galactofuranosyl transferase glft1
CommentsMb3811, -, len: 304 aa. Equivalent to Rv3782, len: 304 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 304 aa overlap). Possible L-rhamnosyltransferase (EC 2.4.1.-), equivalent to Q9CDA1|RFBE|ML0113 PUTATIVE GLYCOSYL TRANSFERASE from Mycobacterium leprae (283 aa), FASTA scores: opt: 1583,E(): 9.3e-96, (81.6% identity in 277 aa overlap). Also some similarity with AAK68916|WCFN PUTATIVE GLYCOSYLTRANSFERASE from Bacteroides fragilis (291 aa) FASTA scores: opt: 241, E(): 2.1e-08, (30.75% identity in 195 aa overlap); O58161|PH0424 HYPOTHETICAL 40.5 KDA PROTEIN from Pyrococcus horikoshii (348 aa), FASTA scores: opt: 194, E(): 2.8e-05, (23.85% identity in 302 aa overlap); O26448|MTH348 RHAMNOSYL TRANSFERASE from Methanothermobacter thermautotrophicus (313 aa) FASTA scores: opt: 177, E(): 0.00033, (28.2% identity in 333 aa overlap); O07868|CPS19BQ PUTATIVE RHAMNOSYL TRANSFERASE FASTA (300 aa) scores: opt: 156, E(): 0.0074, (25.45% identity in 232 aa overlap); and other putative transferases. Note that C-terminal end shows some similarity with part of Q05161|RFB O-ANTIGEN BIOSYNTHESIS PROTEIN B from Escherichia coli strain 0101. Note that previously known as rfbE.
Functional categoryCell wall and cell processes
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41646424165556+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3811|glft1
MTESVFAVVVTHRRPDELAKSLDVLTAQTRLPDHLIVVDNDGCGDSPVRELVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQDARVLATLLACAEKYSLAEVSPMVCNIDDPTRLAFPLRRGLVWRRRASELRTEAGQELLPGIASLFNGALFRASTLAAIGVPDLRLFIRGDEVEMHRRLIRSGLPFGTCLDAAYLHPCGSDEFKPILCGRMHAQYPDDPGKRFFTYRNRGYVLSQPGLRKLLAQEWLRFGWFFLVTRRDPKGLWEWIRLRRLGRREKFGKPGGSA
      
Bibliography
No article yet recorded