Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productdecaprenylphosphoryl-d-2-keto erythro pentose reductase
CommentsMb3820, -, len: 254 aa. Equivalent to Rv3791, len: 254 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 254 aa overlap). Probable short-chain dehydrogenase/reductase (EC 1.-.-.-), equivalent to Q9CDA5|ML0108 PUTATIVE OXIDOREDUCTASE from Mycobacterium leprae (254 aa), FASTA scores: opt: 1458, E(): 1.6e-83,(89.0% identity in 254 aa overlap); and O05764 PUTATIVE PROTEIN BELONGING TO THE SHORT-CHAIN ALCOHOL DEHYDROGENASE from Mycobacterium smegmatis (254 aa), FASTA scores: opt: 1412, E(): 1.2e-80, (85.05% identity in 254 aa overlap). Also highly similar to Q9KZA5|SC5G8.09c PUTATIVE SHORT-CHAIN DEHYDROGENASE from Streptomyces coelicolor (256 aa), FASTA scores: opt: 733, E(): 1.8e-38, (45.3% identity in 254 aa overlap); and P43168|YMP3_STRCO HYPOTHETICAL OXIDOREDUCTASE from Streptomyces coelicolor (251 aa), FASTA scores: opt: 623, E(): 1.2e-31, (42.15% identity in 254 aa overlap); and similar to various oxidoreductases (principally acetoacetyl-CoA reductases) e.g. P14697|PHBB_ALCEU ACETOACETYL-COA REDUCTASE (EC 1.1.1.36) (246 aa) from Alcaligenes eutrophus (Ralstonia eutropha) (246 aa) FASTA scores: opt: 264, E(): 2.3e-09,(29.9% identity in 204 aa overlap); P45375|PHBB_CHRVI ACETOACETYL-COA REDUCTASE from Chromatium vinosum (246 aa), FASTA scores: opt: 261, E(): 3.5e-09, (27.45% identity in 226 aa overlap); Q9RT30|DR1938 OXIDOREDUCTASE (SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY) from Deinococcus radiodurans (283 aa), FASTA scores: opt: 251,E(): 1.7e-08, (27.55% identity in 236 aa overlap); etc. Also similar to Q10681|YK73_MYCTU|Rv2073c|MT2133|MTCY49.12 PUTATIVE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE from Mycobacterium tuberculosis (249 aa), FASTA scores: opt: 589, E(): 1.5e-29, (41.25% identity in 252 aa overlap). Contains PS00061 Short-chain dehydrogenases/reductases family signature. BELONGS TO THE SHORT-CHAIN DEHYDROGENASES/REDUCTASES (SDR) FAMILY.
Functional categoryLipid metabolism
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41734604174224+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3820|dpre2
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGARSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMVLRHIPRSIFRKLPI
      
Bibliography
No article yet recorded