Gene Mb3892c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible transcriptional regulatory protein whib-like whib6 |
| Comments | Mb3892c, whiB6, len: 116 aa. Equivalent to Rv3862c,len: 116 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 116 aa overlap). Possible whiB6,WhiB-like regulatory protein (see citation below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Shows similarity with Q49765|WHIB7|ML0639|B1937_F2_68 PUTATIVE TRANSCRIPTIONAL REGULATOR WHIB7 from Mycobacterium leprae (89 aa) FASTA scores: opt: 112, E(): 0.49, (41.2% identity in 51 aa overlap). Some similarity to Q9AD55|SCP1.95 PUTATIVE REGULATORY PROTEIN from Streptomyces coelicolor (102 aa) FASTA scores: opt: 129, E(): 0.038, (32.95% identity in 85 aa overlap); AAK47632|MT3290.1 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis strain CDC1551 (96 aa), FASTA scores: opt: 126, E(): 0.058, (33.35% identity in 84 aa overlap); Q9FC80|SC4B10.07 CONSERVED HYPOTHETICAL PROTEIN from Streptomyces coelicolor (88 aa), FASTA scores: opt: 119, E(): 0.16, (44.65% identity in 70 aa overlap); Q9K4K8|SC5F8.16c REGULATORY PROTEIN from Streptomyces coelicolor (83 aa), FASTA scores: opt: 114,E(): 0.34, (37.05% identity in 54 aa overlap); etc. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4274444 | 4274794 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3892c|whiB6
MRYAFAAEATTCNAFWRNVDMTVTALYEVPLGVCTQDPDRWTTTPDDEAKTLCRACPRRWLCARDAVESAGAEGLWAGVVIPESGRARAFALGQLRSLAERNGYPVRDHRVSAQSA
Bibliography
No article yet recorded