Gene Rv3862c (whmF)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein WhiB-like WhiB6 |
| Comments | Rv3862c, (MTCY01A6.06), len: 116 aa. Possible whiB6 (alternate gene name: whmF), WhiB-like regulatory protein (see citation below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Shows similarity with Q49765|WHIB7|ML0639|B1937_F2_68 putative transcriptional regulator WHIB7 from Mycobacterium leprae (89 aa) FASTA scores: opt: 112, E(): 0.49, (41.2% identity in 51 aa overlap). Some similarity to Q9AD55|SCP1.95 putative regulatory protein from Streptomyces coelicolor (102 aa) FASTA scores: opt: 129, E(): 0.038, (32.95% identity in 85 aa overlap); AAK47632|MT3290.1 conserved hypothetical protein from Mycobacterium tuberculosis strain CDC1551 (96 aa), FASTA scores: opt: 126, E(): 0.058, (33.35% identity in 84 aa overlap); Q9FC80|SC4B10.07 conserved hypothetical protein from Streptomyces coelicolor (88 aa), FASTA scores: opt: 119, E(): 0.16, (44.65% identity in 70 aa overlap); Q9K4K8|SC5F8.16c regulatory protein from Streptomyces coelicolor (83 aa), FASTA scores: opt: 114, E(): 0.34, (37.05% identity in 54 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4338171 | 4338521 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3862c|whiB6
MRYAFAAEATTCNAFWRNVDMTVTALYEVPLGVCTQDPDRWTTTPDDEAKTLCRACPRRWLCARDAVESAGAEGLWAGVVIPESGRARAFALGQLRSLAERNGYPVRDHRVSAQSA
Bibliography
- Hutter B and Dick T [1999]. Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor. Homolog Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
