Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productesx-1 secretion-associated protein espe
CommentsMb3894, -, len: 418 aa. Equivalent to Rv3864, len: 402 aa, from Mycobacterium tuberculosis strain H37Rv,(96.2% identity in 418 aa overlap). Conserved hypothetical protein, similar to Q49722|ML0405|B1620_C2_213|MLCL383.01 HYPOTHETICAL 40.8 KDA PROTEIN from Mycobacterium leprae (394 aa) FASTA scores: opt: 397, E(): 1.2e-12, (31.0% identity in 410 aa overlap). Also similar to various proteins from several organisms e.g. Q9VYF9|CG12723 HYPOTHETICAL PROTEIN from Drosophila melanogaster (Fruit fly) (450 aa), FASTA scores: opt: 291, E(): 2.3e-07,(34.6% identity in 130 aa overlap); Q98UE3 PROCOLLAGEN ALPHA1(III) (FRAGMENT) from Xenopus laevis (African clawed frog) (117 aa) FASTA scores: opt: 257, E(): 3.6e-06,(41.75% identity in 103 aa overlap); P27393|CA24_ASCSU COLLAGEN ALPHA 2(IV) CHAIN PRECURSOR from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (1763 aa), FASTA scores: opt: 273, E(): 5.7e-06, (32.1% identity in 240 aa overlap); etc. Also similar to O06267|Rv3616c|MTCY07H7B.06 (392 aa) FASTA scores: opt: 389, E(): 3e-12, (31.6% identity in 399 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 36 bp insertion leads to a longer product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (418 aa versus 402 aa).
Functional categoryCell wall and cell processes
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42765424277798+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3894|espe
MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLAIPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTRDVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGALLYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPPKLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPSLPGFPGLPGFPEFPAIPGFPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFAGLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQAQLISSQAQQGGQQHATLVSDKKEDEEGAAAGVAEAERAPIDAGTAASQRGQEGTVL
      
Bibliography
No article yet recorded