Gene Rv3864
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | ESX-1 secretion-associated protein EspE |
| Comments | Rv3864, (MTCY01A6.04c), len: 402 aa. EspE, ESX-1 secretion-associated protein, similar to Q49722|ML0405|B1620_C2_213|MLCL383.01 hypothetical 40.8 KDA protein from Mycobacterium leprae (394 aa) FASTA scores: opt: 397, E(): 1.2e-12, (31.0% identity in 410 aa overlap). Also similar to various proteins from several organisms e.g. Q9VYF9|CG12723 hypothetical protein from Drosophila melanogaster (Fruit fly) (450 aa), FASTA scores: opt: 291, E(): 2.3e-07, (34.6% identity in 130 aa overlap); Q98UE3 procollagen ALPHA1(III) (fragment) from Xenopus laevis (African clawed frog) (117 aa) FASTA scores: opt: 257, E(): 3.6e-06, (41.75% identity in 103 aa overlap); P27393|CA24_ASCSU collagen alpha 2(IV) chain precursor from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (1763 aa), FASTA scores: opt: 273, E(): 5.7e-06, (32.1% identity in 240 aa overlap); etc. Also similar to O06267|Rv3616c|MTCY07H7B.06 (392 aa) FASTA scores: opt: 389, E(): 3e-12, (31.6% identity in 399 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth and cytotoxicity of M. tuberculosis H37Rv Rv3864 mutant in THP-1 cells is comparable to wild-type (See Guinn et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4340270 | 4341478 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3864|espE
MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLAIPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTRDVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGALLYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPPKLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPEFPAIPGFPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFAGLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQAQLISSQAQQGGQQHATLVSDKKEDEEGVAEAERAPIDAGTAASQRGQEGTVL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Guinn KM et al. [2004]. Individual RD1-region genes are required for export of ESAT-6/CFP-10 and for virulence of Mycobacterium tuberculosis. Mutant
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant