Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductESX-1 secretion-associated protein EspE
CommentsRv3864, (MTCY01A6.04c), len: 402 aa. EspE, ESX-1 secretion-associated protein, similar to Q49722|ML0405|B1620_C2_213|MLCL383.01 hypothetical 40.8 KDA protein from Mycobacterium leprae (394 aa) FASTA scores: opt: 397, E(): 1.2e-12, (31.0% identity in 410 aa overlap). Also similar to various proteins from several organisms e.g. Q9VYF9|CG12723 hypothetical protein from Drosophila melanogaster (Fruit fly) (450 aa), FASTA scores: opt: 291, E(): 2.3e-07, (34.6% identity in 130 aa overlap); Q98UE3 procollagen ALPHA1(III) (fragment) from Xenopus laevis (African clawed frog) (117 aa) FASTA scores: opt: 257, E(): 3.6e-06, (41.75% identity in 103 aa overlap); P27393|CA24_ASCSU collagen alpha 2(IV) chain precursor from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (1763 aa), FASTA scores: opt: 273, E(): 5.7e-06, (32.1% identity in 240 aa overlap); etc. Also similar to O06267|Rv3616c|MTCY07H7B.06 (392 aa) FASTA scores: opt: 389, E(): 3e-12, (31.6% identity in 399 aa overlap).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth and cytotoxicity of M. tuberculosis H37Rv Rv3864 mutant in THP-1 cells is comparable to wild-type (See Guinn et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43402704341478+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3864|espE
MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLAIPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTRDVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGALLYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPPKLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPEFPAIPGFPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFAGLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQAQLISSQAQQGGQQHATLVSDKKEDEEGVAEAERAPIDAGTAASQRGQEGTVL