Gene Mb3896
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 secretion-associated protein espg1 |
| Comments | Mb3896, -, len: 283 aa. Equivalent to Rv3866, len: 283 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 283 aa overlap). Conserved hypothetical protein. N-terminal end highly similar to O33091|MLCB628.20c HYPOTHETICAL 13.1 KDA PROTEIN from Mycobacterium leprae (122 aa), FASTA scores: opt: 260,E(): 2.1e-09, (43.6% identity in 117 aa overlap); and C-terminal end highly similar to O33090|MLCB628.19c HYPOTHETICAL 36.7 KDA PROTEIN from Mycobacterium leprae (338 aa), FASTA scores: opt: 540, E(): 1.4e-26, (54.5% identity in 156 aa overlap). Also similar to Q9CD34|ML2530 POSSIBLE DNA-BINDING PROTEIN from Mycobacterium leprae (289 aa), FASTA scores: opt: 146, E(): 0.058, (28.25% identity in 269 aa overlap) and O53694|Rv0289|MTV035.17 HYPOTHETICAL 31.6 KDA PROTEIN from Mycobacterium tuberculosis (295 aa), FASTA scores: opt: 133, E(): 0.39,(28.15% identity in 277 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4278200 | 4279051 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3896|espg1
MTGPSAAGRAGTADNVVGVEVTIDGMLVIADRLHLVDFPVTLGIRPNIPQEDLRDIVWEQVQRDLTAQGVLDLHGEPQPTVAEMVETLGRPDRTLEGRWWRRDIGGVMVRFVVCRRGDRHVIAARDGDMLVLQLVAPQVGLAGMVTAVLGPAEPANVEPLTGVATELAECTTASQLTQYGIAPASARVYAEIVGNPTGWVEIVASQRHPGGTTTQTDAAAGVLDSKLGRLVSLPRRVGGDLYGSFLPGTQQNLERALDGLLELLPAGAWLDHTSDHAQASSRG
Bibliography
No article yet recorded
